PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00245.1_g00013.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 346aa    MW: 38597.1 Da    PI: 6.056
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00245.1_g00013.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.37.3e-181461148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             +g+WT+eEd +lv +++++G+g+W++++   g++R+ k+c++rw +yl
  Rsa1.0_00245.1_g00013.1 14 KGPWTPEEDIILVSYIQEHGPGNWRSVPTNTGLRRCSKSCRLRWTNYL 61
                             79********************************************97 PP

2Myb_DNA-binding48.52e-1567112148
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                              rg++T  E++ +v++ ++lG++ W++Ia++++  Rt++++k++w+++l
  Rsa1.0_00245.1_g00013.1  67 RGNFTDHEEKMIVHLQALLGNR-WAAIASYLP-ERTDNDIKNYWNTHL 112
                              89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.3E-24564IPR009057Homeodomain-like
PROSITE profilePS5129425.782965IPR017930Myb domain
SuperFamilySSF466894.03E-3011108IPR009057Homeodomain-like
SMARTSM007171.0E-141363IPR001005SANT/Myb domain
PfamPF002491.7E-161461IPR001005SANT/Myb domain
CDDcd001673.96E-111661No hitNo description
Gene3DG3DSA:1.10.10.603.7E-2465117IPR009057Homeodomain-like
SMARTSM007172.0E-1566114IPR001005SANT/Myb domain
PROSITE profilePS5129419.01866116IPR017930Myb domain
PfamPF002491.7E-1367112IPR001005SANT/Myb domain
CDDcd001671.09E-1069112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 346 aa     Download sequence    Send to blast
MGRPPCCEKT GVKKGPWTPE EDIILVSYIQ EHGPGNWRSV PTNTGLRRCS KSCRLRWTNY  60
LRPGIKRGNF TDHEEKMIVH LQALLGNRWA AIASYLPERT DNDIKNYWNT HLKKKLKKIN  120
ESGEEDNDVF SSSKTISQKQ HQSSNKGQWE RRLQTDINMA KQALSEALSL DKKPSSTLSP  180
SSSSPVIIPQ NITSFSSVLL ESCHDPSSFS SSTSTITTTT NLYPSGVYAS SAENIARLLQ  240
DFMKDTPKPL TLTSSSPVSE TGPLASAASE EGGEGFEQSF FSFNSMEETQ NLTHETNFFH  300
DQESKPAITM DHDFGLISQG SLSLLEKWLF DENMVGMSLE GQEAIF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1msf_C1e-25141164105C-Myb DNA-Binding Domain
1mse_C1e-25141164105C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2289770.0AK228977.1 Arabidopsis thaliana mRNA for MYB96 transcription factor-like protein, complete cds, clone: RAFL16-28-G04.
GenBankBT0248880.0BT024888.1 Arabidopsis thaliana At5g62470 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013664565.10.0PREDICTED: myb-related protein 306-like
SwissprotQ9SCU71e-108MYB30_ARATH; Transcription factor MYB30
TrEMBLA0A0N7AMM00.0A0A0N7AMM0_BRANA; MYB transcription factor 96-1.1
STRINGBra029258.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62470.20.0myb domain protein 96